PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G15580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 386aa    MW: 40498.3 Da    PI: 6.4518
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G15580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.2e-18262296135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  OPUNC01G15580.1 262 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 296
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.3E-7015346IPR016679Transcription factor, GATA, plant
SMARTSM004011.3E-18256306IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.4E-15256293IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.453256292IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-15258319No hitNo description
CDDcd002021.57E-14261312No hitNo description
PROSITE patternPS003440262287IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15262296IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MEATAEYGVA YYGGAAGREK KALQQGCGDH FAVDDLLVLP YDEEDEITRE GEAAGGGKEE  60
AAGFGNASAD SSTITALDSC SNSFGLADGD FSGELCEPYD QLAELEWLSN YMGEGDDAFA  120
TEDLQKLQLI SGIPSGGFST ASVPSAQAAS AAASMAVQPG GFLPEAPVPA KARSKRSRAA  180
PGNWSSRLLV LPPPPASPPS PASMAISPAE SGVSAHAFPI KKPSKPAKKK DAPAPPQVQL  240
SSVPVHSGGS APAAAAGEGR RCLHCETDKT PQWRTGPMGP KTLCNACGVR YKSGRLVPEY  300
RPAASPTFMV SKHSNSHRKV LELRRQKEMH QQTPPHHHQP HVATGGGVGS LMHMQSSMLF  360
DGVSPVVSGD DFLIHHHLGT DFRQLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218960.0AK121896.1 Oryza sativa Japonica Group cDNA clone:J033105E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631175.10.0PREDICTED: GATA transcription factor 12
TrEMBLA0A0E0JIL60.0A0A0E0JIL6_ORYPU; Uncharacterized protein
STRINGBGIOSGA000840-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.12e-52GATA transcription factor 12